IGF-1
From $89.00
IGF-1 (Insulin-like Growth Factor-1) – Research Grade 1MG
Recombinant human 70-amino-acid single-chain polypeptide with three intramolecular disulfide bridges. CAS: 67763-96-6. Molecular Weight: ~7.6 kDa. Purity ≥98% verified by HPLC. For in-vitro laboratory research applications only. Not for human or veterinary use.
Product Overview
IGF-1, also known as Somatomedin C, is a recombinant human 70-amino-acid single-chain polypeptide. The protein features three intramolecular disulfide bridges that stabilize its tertiary structure. The amino acid sequence is identical to that of endogenous human IGF-1.
Technical Specifications
| Sequence (1-Letter) | GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
|---|---|
| Number of Amino Acids | 70 |
| Disulfide Bridges | Three intramolecular bridges |
| CAS Number | 67763-96-6 |
| Molecular Weight | ~7.6 kDa (7649 Da) |
| Purity (HPLC) | ≥98% |
| Physical Form | Lyophilized powder |
| Vial Content | 1 mg |
Structural Context
IGF-1 is a 70-amino-acid single-chain polypeptide cross-linked by three intramolecular disulfide bridges. The structure displays homology to proinsulin: positions 1 to 29 correspond to the insulin B chain, and positions 42 to 62 correspond to the insulin A chain. A 12-residue connecting peptide (positions 30 to 41) shows no homology to the proinsulin C-peptide. The molecule contains an octapeptide sequence at the C-terminal end that is not found in proinsulins. All half-cystine and glycine residues, along with most nonpolar core residues of the insulin monomer, are conserved, supporting a three-dimensional structure similar to that of insulin.
Handling and Storage
The peptide is supplied in lyophilized (freeze-dried) powder form in a 1 mg vial. For optimal stability, store lyophilized material at or below -20°C. Protect from repeated freeze-thaw cycles, moisture, and prolonged exposure to light.
Research Applications
This product is manufactured and supplied as a chemical reference standard for in-vitro laboratory research applications including analytical method development, chromatographic reference studies, structural characterization, and protein stability assessments in controlled laboratory environments.
| IGF-1 | 1Pack, 3Pack |
|---|
Related products
-
Bioenergetics Research
Wolverine
From $100.00 Select options This product has multiple variants. The options may be chosen on the product page -
All Reference Standards
KLOW
From $125.00 Select options This product has multiple variants. The options may be chosen on the product page -
Connective Tissue Assays
Retatrutide
From $110.00 Select options This product has multiple variants. The options may be chosen on the product page -
Connective Tissue Assays
Tesamorelin
From $100.00 Select options This product has multiple variants. The options may be chosen on the product page
